>_Telegraphictelegraphic.dev
Blog Talks Projects About

Blog

84 articles

Tags

agents (2) ai (6) blobstore (1) bugfix (1) claude (3) codex (2) datastore (4) development (1) files (1) gaelyk (2) gaelyk 2.0 (8) gradle (1) groovlets (2) hetzner (1) json (1) migration (1) openclaw (6) params (1) pikarama (1) plugins (1) query dsl (3) rest (1) routes (1) telegram (1) telegraphic (2) templates (2)
April 4, 2026

How to Survive OpenClaw on Codex

openclawcodexaiagentsclaude
March 20, 2026

OpenClaw vs Claude Code: One Month Later

openclawclaudeaiagentscodex
February 19, 2026

OpenClaw vs Claude Code: Why Memory Makes All the Difference

openclawaiclaude
February 15, 2026

My Very First Telegraphic Application

openclawpikaramaaitelegraphicdevelopment
February 8, 2026

Finding Jean a New Home

openclawaihetznermigration
February 1, 2026

How I Became a Telegraphic Developer

openclawaitelegramtelegraphic
January 7, 2025

Scaling up into the Cloud - Agorapulse Micronaut Journey

May 29, 2024

Micronaut MockBean Explained

November 24, 2021

How to Update Dependency Version in Multiple GitHub Repositories

October 13, 2021

How to use Micronaut in AWS Batch

September 3, 2021

Gradle Configurations Explained: What is the difference between API and Implementation?

August 23, 2021

How to Debug Your Own IntelliJ IDEA Instance

August 5, 2021

How to Resolve Conflicts in Micronaut 1.x and 2.x Library Versions in Gradle

August 3, 2021

Goodbye Grails, Hello Micronaut #10: Micronaut Data

August 3, 2021

Goodbye Grails, Hello Micronaut #9: Micronaut Application

August 3, 2021

Goodbye Grails, Hello Micronaut #8: Controllers

August 3, 2021

Goodbye Grails, Hello Micronaut #7: Services

August 3, 2021

Goodbye Grails, Hello Micronaut #6: Domain Classes

August 3, 2021

Goodbye Grails, Hello Micronaut #5: Marshalling

August 3, 2021

Goodbye Grails, Hello Micronaut #4: Datasets

August 3, 2021

Goodbye Grails, Hello Micronaut #3: Static Compilation

August 3, 2021

Goodbye Grails, Hello Micronaut #2: Configuration

August 3, 2021

Goodbye Grails, Hello Micronaut #1: Multiproject

August 3, 2021

Goodbye Grails, Hello Micronaut #0: Introduction

July 16, 2021

How to Use OkHttp 4.x with Grails

February 3, 2021

How to Compile Groovy Statically by Default

October 19, 2020

How to Work with Multiline String Variables in GitHub Actions

September 30, 2020

How to Debug CORS Issues with Chrome and IntelliJ IDEA

June 24, 2020

How to Share GORM Domain Classes between Grails and Micronaut

February 10, 2020

How to Set the Default Configuration Properties for a Micronaut Library

December 10, 2019

How to Efficiently Upgrade to Latest Version of Gradle

December 3, 2019

How to Manage Versions using Maven BOM, Gradle and GitHub

December 2, 2019

How to Benefit from Grails 4 Upgrade

October 16, 2019

How to Support Secured Connections inside Micronaut’s GraalVM

September 5, 2019

How to Reduce Code in Grails Controllers to Minimum

July 8, 2019

Code Smell: Variable Initialized inside If-Else Conditional Block

February 20, 2019

How to Setup AWS DynamoDB Accelerator (DAX) with Micronaut

January 29, 2019

How to Emulate Event Bus with Micronaut, API Gateway and SNS

January 22, 2019

How to Create WebSocket Backend with API Gateway and Micronaut

January 9, 2019

How to Mock Micronaut Beans in Tests

November 30, 2018

Groovy DSL Builders #10: The Conclusion

November 30, 2018

Groovy DSL Builders #9: The Navigation

November 30, 2018

Groovy DSL Builders #8: The Resignation

November 30, 2018

Groovy DSL Builders #7: The Extension

November 30, 2018

Groovy DSL Builders #6: The Expectations

November 30, 2018

Groovy DSL Builders #5: The Desiccation

November 30, 2018

Groovy DSL Builders #4: The Disguise

November 30, 2018

Groovy DSL Builders #3: The Aid

November 30, 2018

Groovy DSL Builders #2: The Essence

November 30, 2018

Groovy DSL Builders #1: The Concept

October 19, 2018

How to Deploy Java Application with Docker and GraalVM

October 8, 2018

jOpenSpace 2018 Notes

October 4, 2018

How to Create Library Suitable for Grails with Micronaut

September 17, 2018

Why you should avoid using push and pop method on lists in Groovy

September 14, 2018

In that case, you are trying a wrong way.

September 4, 2018

How to Handle Changes in Gru's JSON Fixtures

August 30, 2018

How to Unit Test AWS Services with LocalStack and Testcontainers

July 27, 2018

Groovy Developer Manifesto

July 26, 2018

The Easiest Way How to Display All Spock's Mock Interactions

July 25, 2018

How to Run Your Java AWS API Gateway Lambda Projects Locally with Micronaut

June 14, 2018

Let Your Groovy Code Remember Your Sins

May 31, 2018

How to prepare test data in Micronaut with Dru

May 31, 2018

Micronaut: The Missing Part

May 30, 2018

How to test Micronaut with Gru?

March 17, 2018

What is Micronaut?

March 12, 2018

How to solve “now problem” in your Java tests

December 4, 2017

How to Obtain Heap Dump of AWS Beanstalk Java Application

November 9, 2017

How to Deploy Java Application JAR to AWS Beanstalk with Gradle

October 8, 2017

Four Phases to Accomplish before Open Sourcing Your Tool

October 5, 2017

Leveraging Spock Spring Module in Grails Unit Tests

September 28, 2017

The Flaws in Polyglot Persistence

August 30, 2017

Testing Spring MVC Applications with Gru

August 24, 2017

Testing Legacy API Endpoints with Gru

May 17, 2013

Gaelyk 2.0 Released

gaelyk 2.0
April 3, 2013

Everyday Gaelyk: Common Query DSL pitfalls

gaelykdatastorequery dsl
March 21, 2013

Everyday Gaelyk: Handle long running datastore queries gracefully

gaelyk 2.0datastorequery dsl
March 21, 2013

Everyday Gaelyk: Save your query dsl for later use

datastorequery dsl
March 19, 2013

Everyday Gaelyk: Solving java.lang.NoClassDefFoundError: com/google/appengine/api/search/AddResponse

gaelyk 2.0gaelykbugfix
March 19, 2013

Everyday Gaelyk: Find blob file by name

datastoreblobstorefiles
March 17, 2013

Everyday Gaelyk: Simplify flow in groovlets by handling their return values

pluginsgaelyk 2.0jsonrest
March 16, 2013

Everyday Gaelyk: Handling input parameters gracefully

gaelyk 2.0groovletstemplatesparams
March 16, 2013

Everyday Gaelyk: Living on the edge with Gaelyk snapshots

gaelyk 2.0gradle
March 16, 2013

Everyday Gaelyk: More readable routes with optional path parameters

gaelyk 2.0routes
March 15, 2013

Everyday Gaelyk: Adding methods to groovlets and templates

gaelyk 2.0groovletstemplates

© 2026 Telegraphic. All rights reserved.

Substack Bluesky X GitHub